PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g37377.1.p
Common NameBRADI_2g37377, LOC100836443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 266aa    MW: 30027.8 Da    PI: 5.3388
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g37377.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.7e-152774148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed +lv  v++lG ++W+  a+  g++Rt+k+c++rw +yl
  Bradi2g37377.1.p 27 KGPWTEQEDAQLVWFVRLLGERRWDFLAQVSGLRRTGKSCRLRWVNYL 74
                      79********************************************97 PP

2Myb_DNA-binding54.23.4e-1780124147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr T++E+ l+++++ q+G++ W++Iar+++ gRt++++k++w+++
  Bradi2g37377.1.p  80 RGRITPDEERLILQLHSQWGSR-WSRIARRLP-GRTDNEIKNYWRTL 124
                       89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3832274IPR017930Myb domain
SMARTSM007174.5E-122676IPR001005SANT/Myb domain
SuperFamilySSF466892.77E-2726121IPR009057Homeodomain-like
PfamPF002493.6E-132774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-192881IPR009057Homeodomain-like
CDDcd001679.29E-82974No hitNo description
PROSITE profilePS5129423.55375129IPR017930Myb domain
SMARTSM007179.9E-1679127IPR001005SANT/Myb domain
PfamPF002493.6E-1580124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2382127IPR009057Homeodomain-like
CDDcd001673.52E-1084124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MRDNSSKSGG NNGKMTKITV AMMLNRKGPW TEQEDAQLVW FVRLLGERRW DFLAQVSGLR  60
RTGKSCRLRW VNYLHPGLKR GRITPDEERL ILQLHSQWGS RWSRIARRLP GRTDNEIKNY  120
WRTLTRKLKA ADKTTSPETK KKEALLLTAE DSSSMSSSVT AVSSSVVTGG GTEEMRRTEE  180
AGEAEETEEE ATTAASEKKP EKDMEMEELW DEIAAAEMAM AAASWPGLQV GQELLPPPSS  240
PAWEDYSLWR IDDEEYYSKI EGALN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-25271274103MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-25271274103C-Myb DNA-Binding Domain
1msf_C5e-25271274103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519041e-85JF951904.1 Triticum aestivum clone TaMYB20 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566622.10.0PREDICTED: transcription factor MYB59-like
TrEMBLI1HMC30.0I1HMC3_BRADI; Uncharacterized protein
STRINGBRADI2G37377.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.12e-58myb domain protein 48